PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002267.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family BES1
Protein Properties Length: 329aa    MW: 35252.6 Da    PI: 9.4331
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002267.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.81.8e-65301582131
                   DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssas 87 
                              +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+  +e++g+sa+
  Itr_sc002267.1_g00004.1  30 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCQEAGWTVEPDGTTYRKGCKPT-PMEIGGTSAN 114
                              689************************************************************************.********** PP

                   DUF822  88 aspesslqsslkssalaspvesysaspksssfpspssldsisla 131
                              ++p+ss + s+ ss++aspv+sy++sp sss psp++   +  +
  Itr_sc002267.1_g00004.1 115 ITPSSSRNPSPPSSYFASPVPSYQPSPLSSSCPSPTHHGAADGK 158
                              ************************************98776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-6130152IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MMMWEGGGGS ATSPPPPGGG DGGGGGGSIS GRRKPSWRER ENNRRRERRR RAIAAKIYAG  60
LRAQGNYNLP KHCDNNEVLK ALCQEAGWTV EPDGTTYRKG CKPTPMEIGG TSANITPSSS  120
RNPSPPSSYF ASPVPSYQPS PLSSSCPSPT HHGAADGKMP PHPFAFLRSA IPSSLPPLRI  180
SSSAPVTPPI SSPTRAPPKQ IFNLETLAKE SMSAFNIPFF ASAPTSPTRA HQRFPATIPE  240
CDESDSSTID SGHWMSFQKY GVPTSPTFNL MKPVNPQRVP SNDAMILDKG KSVDFGFENV  300
AVKAWEGERI HEVGLDDLEL TLGSGTARI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13150RRKPSWRERENNRRRERRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-146PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-115BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV771e-145K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.11e-144(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.26e-93BES1 family protein